PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00218.1.g00470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 445aa    MW: 50519.8 Da    PI: 9.8982
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00218.1.g00470.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.7e-20189236148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT++Ed+ll+++v+q+G g+W+++a+  g+gR++k+c++rw +yl
  Zmw_sc00218.1.g00470.1.am.mk 189 KGPWTAQEDKLLLEYVRQHGEGRWNSVAKLTGLGRSGKSCRLRWVNYL 236
                                   79********************************************97 PP

2Myb_DNA-binding50.16.5e-16242286147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc00218.1.g00470.1.am.mk 242 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 286
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.314184236IPR017930Myb domain
SuperFamilySSF466891.27E-30187283IPR009057Homeodomain-like
SMARTSM007171.4E-17188238IPR001005SANT/Myb domain
PfamPF002495.9E-19189236IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-25190243IPR009057Homeodomain-like
CDDcd001671.25E-12191236No hitNo description
PROSITE profilePS5129424.933237291IPR017930Myb domain
SMARTSM007174.5E-15241289IPR001005SANT/Myb domain
PfamPF002491.2E-13242286IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-23244289IPR009057Homeodomain-like
CDDcd001671.45E-9246287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MHRRRGGRPG GFRRWRRPPR FGCTDRASSA FLRLTASRGF FFPHRRSDLD ERSGGQVFRD  60
EAEDLTVRLR VSLPSWRRFY NEAEPFIHAL PILDQHNGYP GRLLAVAETW FIPVVATTGN  120
TKIAGAKLHP QVEATLSAEN PTLTRSFTED RGRQRGSRRL ISSIVDRQKK RLEMEGQFGW  180
GREEGGWRKG PWTAQEDKLL LEYVRQHGEG RWNSVAKLTG LGRSGKSCRL RWVNYLRPDL  240
KRGKITPQEE SVILELHALW GNRWSTIARS LPGRTDNEIK NYWRTHFKKG KPSKNIERAR  300
ARFLKQRCEM KSQLLLQGQE PPPPQPQQQL EETDHDDAAT GKAAPVACLA QQNEALKMML  360
DMDDLLYQLC PMSSCSSSYH LHGGSGSGSA SAASEGSSED QLQTGYTWGW GSLWNLEGVV  420
DDIDGGACGW DSSFTWLQDQ RLAFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-261892897106B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165170DRQKKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454181.11e-125hypothetical protein SORBIDRAFT_04g026210
TrEMBLC5XXQ51e-125C5XXQ5_SORBI; Putative uncharacterized protein Sb04g026210
STRINGSb04g026210.11e-125(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584